LLPS000004:   LAF-1
General information  
Link to protein
LAF-1   
Componentsprotein(1) + RNA
Protein structureIDR-fold
Nucleic acid(s)polyA_Repeat:30nt
Modification[LAF-1]_WT
Sequence length[LAF-1]:708aa(1-708)
Sequence>LLPS000004 sp|D0PV95|DDX3_CAEEL ATP-dependent RNA helicase laf-1 OS=Caenorhabditis elegans OX=6239 GN=laf-1 PE=1 SV=1|length=708aa|residues=1-708
MESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGN
SGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGG
GGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGQNTRWNNLDAPP
SRGTSKWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVPQPISLFSDLSLHE
WIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDA
VHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQI
HKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRM
PSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRS
YLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRT
GTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKN
RNIARELMDLIVEANQELPDWLEGMSGDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGN
GGGGNGGGGGFGGGGQRSGGGGGFQSGGGGGRQQQQQQRAQPQQDWWS

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
0-9 mg/ml [LAF-1];7.5 µM polyA0-500 mM NaCl20 mM Tris, pH 7.4, 1 mM DTT--RTN/A-Microscopy Phase diagram droplet refer to 29064502 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1