LLPS000008:   LAF-1_m
General information  
Link to protein
LAF-1   
Componentsprotein(1)
Protein structureIDR
Nucleic acid(s)-
Modification[LAF-1 RGG]2_Cleaved_Repeat(A tandem RGG protein in which two RGG domains are connected by a short linker)
Sequence length[LAF-1 RGG]2:340aa
Sequence>LLPS000008 synthetic protein construct [LAF-1 RGG]2|length=340aa
ESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNS
GGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGG
GYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFGKLMESNQSNN
GGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGG
YDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDR
GDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5--<37℃N/A-Turbidity measurement(reversible) Yes liquid droplet refer to 30061688 Yes
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5-->37℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
0-12 µM [LAF-1 RGG]2150-1000 mM NaCl20 mM Tris, pH 7.5--25℃N/A-Microscopy(fuse);FRAP Phase diagram liquid droplet refer to 30061688 Yes
3 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5--<33℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
3 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5-->33℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
12 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5--<40℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
12 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5-->40℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.5--25℃N/A0.01 mg/ml rhodamine BMicroscopy Yes droplet refer to 30061688 Yes
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.510 mg/ml dextrans-4K-25℃N/A-Microscopy Yes droplet refer to 30061688 Yes
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.510 mg/ml dextrans-10K-25℃N/A-Microscopy Yes droplet refer to 30061688 Yes
6 µM [LAF-1 RGG]2150 mM NaCl20 mM Tris, pH 7.510 mg/ml dextrans-70K-25℃N/A-Microscopy Yes droplet refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1