LLPS000009:   LAF-1_m
General information  
Link to protein
LAF-1   
Componentsprotein(1)
Protein structureIDR
Nucleic acid(s)-
Modification[LAF-1 RGG]3_Cleaved_Repeat(A tandem RGG protein in which three RGG domains are connected by two short linkers)
Sequence length[LAF-1 RGG]3:539aa
Sequence>LLPS000009 synthetic protein construct [LAF-1 RGG]3|length=539aa
MESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGN
SGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGG
GGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFENLYFQGGSL
VPRGSMESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYR
RGGGNSGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNN
RGGGGGGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGGTLEVLF
QGPEFLVPRGSMESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGA
GGGGYRRGGGNSGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGN
RGYNNNRGGGGGGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
4 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5--<50℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
4 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5-->50℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
2 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5--<43℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
2 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5-->43℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
4 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5--<47℃N/A-Turbidity measurement;Microscopy(fuse) Yes liquid droplet refer to 30061688 Yes
4 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5-->47℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
8 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5--<52℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
8 µM [LAF-1 RGG]3150 mM NaCl20 mM Tris, pH 7.5-->52℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
4 µM [LAF-1 RGG]3500 mM NaCl20 mM Tris, pH 7.5--<35℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
4 µM [LAF-1 RGG]3500 mM NaCl20 mM Tris, pH 7.5-->35℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes
4 µM [LAF-1 RGG]31000 mM NaCl20 mM Tris, pH 7.5--<28℃N/A-Turbidity measurement Yes droplet refer to 30061688 Yes
4 µM [LAF-1 RGG]31000 mM NaCl20 mM Tris, pH 7.5-->28℃N/A-Turbidity measurement No transparent solution refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1