LLPS000010:   LAF-1_m
General information  
Link to protein
LAF-1   
Componentsprotein(1)
Protein structureIDR-fold
Nucleic acid(s)-
Modification[LAF-1△C]_Cleaved(Deleted the C-terminal R/G/Q rich domain of LAF-1.)
Sequence length[LAF-1△C]:647aa(1-647)
Sequence>LLPS000010 sp|D0PV95|DDX3_CAEEL ATP-dependent RNA helicase laf-1 OS=Caenorhabditis elegans OX=6239 GN=laf-1 PE=1 SV=1|length=647aa|residues=1-647
MESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGN
SGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGG
GGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGQNTRWNNLDAPP
SRGTSKWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVPQPISLFSDLSLHE
WIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDA
VHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQI
HKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRM
PSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRS
YLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRT
GTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKN
RNIARELMDLIVEANQELPDWLEGMSGDMRSGGGYRGRGGRGNGQRF

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
0-0.8mg/ml [LAF-1△C]100-400 mM NaCl20 mM Tris, pH 7.4, 1 mM DTT--20℃after 1 h-Microscopy Phase diagram droplet refer to 26015579 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1