LLPS000011:   LAF-1_m
General information  
Link to protein
LAF-1   
Componentsprotein(1)
Protein structureIDR-fold
Nucleic acid(s)-
Modification[LAF-1△RGG]_Cleaved(Deleted the N-terminal RGG domain of LAF-1.)
Sequence length[LAF-1△RGG]:541aa(168-708)
Sequence>LLPS000011 sp|D0PV95|DDX3_CAEEL ATP-dependent RNA helicase laf-1 OS=Caenorhabditis elegans OX=6239 GN=laf-1 PE=1 SV=1|length=541aa|residues=168-708
GQNTRWNNLDAPPSRGTSKWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVP
QPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLV
PLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSA
LLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGF
EPQIRQIVECNRMPSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIM
QKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLK
QFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVG
NVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGDMRSGGGYRGRGGRGNGQRF
GGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGGGGRQQQQQQRAQPQQDWW
S

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
1-250 µM [LAF-1△RGG]125 mM NaCl 20 mM Tris, pH 7.4, 1 mM DTT--RTwithin 1 h-Microscopy No transparent solution refer to 26015579 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1