LLPS000012:   LAF-1_m + EGFP
General information  
Link to protein
LAF-1    EGFP   
Componentsprotein(2)
Protein structureIDR + fold
Nucleic acid(s)-
Modification[LAF-1 RGG]2_Cleaved_Repeat(A tandem RGG protein in which two RGG domains are connected by a short linker)
[EGFP]_WT
Sequence length[LAF-1 RGG]2:340aa
[EGFP]:239aa(1-239)
Sequence>LLPS000012.1 synthetic protein construct [LAF-1 RGG]2|length=340aa
ESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNS
GGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGG
GYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFGKLMESNQSNN
GGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGG
YDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDR
GDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

>LLPS000012.2 tr|C5MKY7|C5MKY7_HCMV Enhanced green fluorescent protein OS=Human cytomegalovirus OX=10359 GN=egfp PE=4 SV=1|length=239aa|residues=1-239
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT
LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
VNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLA
DHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
6 µM [LAF-1 RGG]2;1 µM [EGFP]150 mM NaCl20 mM Tris, pH 7.5--25℃N/A-Microscopy Yes droplet refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1