LLPS000014:   LAF-1_m + mCherry
General information  
Link to protein
LAF-1    mCherry   
Componentsprotein(2)
Protein structureIDR + fold
Nucleic acid(s)-
Modification[LAF-1 RGG]2_Cleaved_Repeat(A tandem RGG protein in which two RGG domains are connected by a short linker)
[mCherry]_WT
Sequence length[LAF-1 RGG]2:340aa
[mCherry]:236aa(1-236)
Sequence>LLPS000014.1 synthetic protein construct [LAF-1 RGG]2|length=340aa
ESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNS
GGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGG
GYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFGKLMESNQSNN
GGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGG
YDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDR
GDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

>LLPS000014.2 tr|X5DSL3|X5DSL3_ANAMA MCherry fluorescent protein OS=Anaplasma marginale OX=770 GN=mCherry PE=1 SV=1|length=236aa|residues=1-236
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
FAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQD
GEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA
EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
6 µM [LAF-1 RGG]2;10 µM [mCherry]150 mM NaCl20 mM Tris, pH 7.5--25℃N/A-Microscopy Yes droplet refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1