LLPS000015:   LAF-1_m + mCherry-LAF-1_m
General information  
Link to protein
LAF-1    mCherry   
Componentsprotein(2)
Protein structureIDR + IDR-fold
Nucleic acid(s)-
Modification[LAF-1 RGG]2_Cleaved_Repeat(A tandem RGG protein in which two RGG domains are connected by a short linker)
[mCherry]-[LAF-1 RGG]_Fusion_Cleaved(A fusion protein construct of mCherry and the N-terminal RGG domain of LAF-1.)
Sequence length[LAF-1 RGG]2:340aa
[mCherry]-[LAF-1 RGG]:419aa(1-236;2-168)
Sequence>LLPS000015.1 synthetic protein construct [LAF-1 RGG]2|length=340aa
ESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNS
GGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGG
GYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFGKLMESNQSNN
GGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGG
YDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDR
GDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

>LLPS000015.2 A fusion protein construct [mCherry]-[LAF-1 RGG] with mCherry fused to LAF-1 RGG domain|length=419aa|residues=1-236
2-168
VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPF
AWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDG
EFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAE
VKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSE
NLYFQGEFGKLMESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGA
GGGGYRRGGGNSGGGGGGGYDRGYNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGN
RGYNNNRGGGGGGYNRQDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
6 µM [LAF-1 RGG]2;1 µM [mCherry]-[LAF-1 RGG]150 mM NaCl20 mM Tris, pH 7.5--25℃N/A-Microscopy Yes droplet refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1