LLPS000016:   FUS
General information  
Link to protein
FUS   
Componentsprotein(1)
Protein structureIDR-fold
Nucleic acid(s)-
Modification[FUS]_WT
Sequence length[FUS]:526aa(1-526)
Sequence>LLPS000016 sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1|length=526aa|residues=1-526
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
800 nM-10 µM [FUS]500 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.410% dextran-RTafter 10 min-Microscopy(flow,fuse);FRAP Yes liquid droplet refer to 26317470 Yes
10 µM [FUS]500 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.410% PEG-RTafter 10 min-Microscopy Yes droplet refer to 26317470 Yes
400 nM [FUS]150 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.49% Dextran-RTafter 1 h-Microscopy No transparent solution refer to 26317470 Yes
10 µM [FUS]500 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.410% dextran-RTwithin 12 h-Microscopy;FRAP;Cryo-EM Yes droplet to fiber refer to 26317470 Yes
4-16 µM [FUS]500 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.410% dextran-RTwithin 480 min-Microscopy Yes droplet to fiber refer to 26317470 Yes
400 nM [FUS]150 mM KCl50 mM Tris/HCl, 2.5% Glycerol, 1 mM DTT, pH 7.49% Dextran-RTafter 1 h1 µM PARMicroscopy Yes droplet refer to 26317470 Yes
5 µM [FUS]150 mM NaCl20 mM Tris pH 7.4--25℃within 3 dagitation 1200 rpmMicroscopy Yes droplet to aggregate refer to 28790177 Yes
5 µM [FUS]150-1000 mM NaCl20 mM Tris pH 7.4--25℃after 45 min-Turbidity measurement Yes droplet refer to 28790177 Yes
5 µM [FUS]50-300 uM NaCl20 mM Tris-HCl pH 7.4--RTafter 30 min-Turbidity measurement Yes droplet refer to 26455390 N/A
5 µM [FUS]150 mM KCl25 mM Tris-HCl 7.4, 2.5% Glycerol, 0.5 mM DTT--RTN/A-Microscopy Yes droplet refer to 29961577 Yes
5 µM [FUS]150 mM KCl25 mM Tris-HCl 7.4, 2.5% Glycerol, 0.5 mM DTT10% Dextran-RTN/A-Microscopy(fuse);A dual-trap optical tweezer instrument Yes liquid droplet refer to 29961577 Yes
≥1 µM [FUS]75 mM KCl25 mM Tris-HCl 7.4, 2.5% Glycerol, 0.5 mM DTT10% Dextran-RTN/A-Microscopy(measuring the supernatant concentration) Yes droplet refer to 29961577 Yes
2 µM [FUS]75 mM KCl25 mM Tris-HCl 7.4, 2.5% Glycerol, 0.5 mM DTT--RTN/A-Microscopy Yes droplet refer to 29961577 Yes
≥2 µM [FUS]75 mM KCl25 mM Tris-HCl 7.4, 2.5% Glycerol, 0.5 mM DTT--RTN/A-Microscopy Yes droplet to fiber refer to 29961577 Yes
7.5 µM [FUS]75 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4), 1 mM TCEP--RTN/A-Microscopy Yes droplet to aggregates refer to 29650702 Yes
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min1-4 mM ATP-MgMicroscopy Yes droplet refer to 28522535 N/A
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≥8 mM ATP-MgMicroscopy No transparent solution refer to 28522535 N/A
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min1-4 mM APPNP-MgMicroscopy Yes droplet refer to 28522535 N/A
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min8 mM APPNP-MgMicroscopy No transparent solution refer to 28522535 N/A
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min1-8 mM Mg-TPMicroscopy Yes droplet refer to 28522535 N/A
5 µM [FUS]4-160 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min-Microscopy Yes droplet refer to 28522535 N/A
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≥3.2 mM GTPMicroscopy No transparent solution refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min＜14 mM ADPMicroscopy Yes droplet refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≥14 mM ADPMicroscopy No transparent solution refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min＜18 mM AMPMicroscopy Yes droplet refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≥18 mM AMPMicroscopy No transparent solution refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≤48 mM NaXSMicroscopy Yes droplet refer to 28522535 N/A
7 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min≥56 mM NaXSMicroscopy No transparent solution refer to 28522535 N/A
7 µM [FUS]150 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--25℃N/A-Microscopy;Turbidity measurement;Sedimentation assay Yes droplet refer to 29677514 Yes
7 µM [FUS]150 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--25℃after 8 hagitationMicroscopy Yes droplet to aggregates refer to 29677514 Yes
7 µM [FUS]150 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--25℃after 90 min-TEM Yes droplet to fibrils refer to 29677514 Yes
9 µM [FUS]150 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT150 mg/ml Ficoll 400-RTN/A-FRAP Yes liquid droplet refer to 29677514 Yes
7 µM [FUS]75 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--RTN/A-Turbidity measurement Yes droplet refer to 29677514 Yes
10 µM [FUS] -50mM Tris-HCl, pH 8, 1 mM DTT, 200 mM trehalose, 20 mM glutathione--25℃after 4 h-Microscopy(fuse) Yes liquid droplet refer to 29677512 Yes
4 µM [FUS]50 mM KCl50mM Tris pH 7.4, 1mM DTT, 0.5% glycerol--RTwithin 120 min-Microscopy;SEM Yes droplet refer to 30021151 Yes
5 µM [FUS]150 mM NaCl20 mM Tris pH 7.4--25℃within 1 d-Microscopy Yes droplet refer to 28790177 Yes
0.1-3 µM [FUS]50-300 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4) 1 mM TCEP--RTN/A-Microscopy Yes droplet refer to 29650702 Yes
5 µM [FUS]70 mM KCl10 mM Tris/HCl, 1 mM DTT, pH 7.4--RTafter 30 min＜3.2 mM GTPMicroscopy Yes droplet refer to 28522535 N/A
20 µM [FUS]70 mM KCl;4 mM ZnCl25 mM sodium phosphate pH 6.0--25℃N/A＜8 mM ATP-MgMicroscopy Yes droplet refer to 30205960 N/A
20 µM [FUS]70 mM KCl;4 mM ZnCl25 mM sodium phosphate pH 6.0--25℃N/A≥8 mM ATP-MgMicroscopy No transparent solution refer to 30205960 N/A
0.5-4 µM [FUS]150 mM NaCl25 mM Tris pH 7.50-175 mg/ml PEG8000-22℃after 2 min-Turbidity measurement;Microscopy Phase diagram droplet refer to 30791483 N/A
10 µM [FUS]150 mM NaCl25 mM Tris pH 7.50-150 mg/ml PEG8000-22℃after 30-45 min-Microscopy;FRAP Yes liquid droplet to gel refer to 30791483 N/A
10 µM [FUS]150 mM NaCl25 mM Tris pH 7.5150 mg/ml PEG300-35000-22℃after 30-45 min-Microscopy;FRAP Yes liquid droplet to gel refer to 30791483 N/A
10 µM [FUS]150 mM NaCl25 mM Tris pH 7.5150 mg/ml Dextran8000-40000-22℃after 30-45 min-Microscopy;FRAP Yes liquid droplet to gel refer to 30791483 N/A
8μM [FUS]150 mM NaCl20 mM HEPES pH 7.4, 2 mM DTT, 2 mM Mg(OAC)2, 10% glycerol--<33.2±1.4℃after 3h-Turbidity measurement Yes droplet refer to 29677513 N/A
2μM [FUS]150 mM NaCl20 mM HEPES pH 7.4, 2 mM DTT, 2 mM Mg(OAC)2, 10% glycerol--<28.3±2.7℃after 3h-Turbidity measurement Yes droplet refer to 29677513 N/A
20μM [FUS]150 mM NaCl5 mM sodium phosphate buffer at pH 6.0, 1 mM MgCl2, 4 mM ZnCl2--25℃N/A-Microscopy Yes droplet refer to 31188823 N/A
1-5 μM [FUS]150 mM NaCl50 mM Tris (pH 7.5)--4℃within 50min-Microscopy(fuse) Yes liquid droplet refer to 26526393 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1