LLPS000018:   FUS
General information  
Link to protein
FUS   
Componentsprotein(1) + RNA
Protein structureIDR-fold
Nucleic acid(s)RNA
Modification[FUS]_WT
Sequence length[FUS]:526aa(1-526)
Sequence>LLPS000018 sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1|length=526aa|residues=1-526
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
5 µM [FUS];1200-2500 ng/ul rRNA75 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4), 1 mM TCEP--RTN/A-Microscopy No transparent solution refer to 29650702 Yes
5 µM [FUS];800-2500 ng/ul tRNA75 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4), 1 mM TCEP--RTN/A-Microscopy No transparent solution refer to 29650702 Yes
5 µM [FUS];2500 ng/ul rRNA75 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4), 1 mM TCEP--RTN/A5 ng/µl RNase AMicroscopy Yes droplet refer to 29650702 Yes
5 µM [FUS];2500 ng/ul tRNA75 mM KCl;1 mM MgCl225 mM Tris/HCl buffer (pH 7.4), 1 mM TCEP--RTN/A5 ng/µl RNase AMicroscopy Yes droplet refer to 29650702 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1