LLPS000070:   FUS_m
General information  
Link to protein
FUS   
Componentsprotein(1) + RNA
Protein structureIDR-fold
Nucleic acid(s)MAPT_(a known FUS target RNA)
Modification[FUS RGG3-PY]_Cleaved
Sequence length[FUS RGG3-PY]:73aa(454-526)
Sequence>LLPS000070 sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1|length=73aa|residues=454-526
GPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDS
RGEHRQDRRERPY

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
15-60 µM [FUS RGG3-PY];add MAPT at a molar ratio of 1:5075 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--25℃N/A-Microscopy Yes droplet refer to 29677514 Yes
2.5-30 µM [FUS RGG3-PY];add MAPT at a molar ratio of 1:5075 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--0-40℃N/A-Microscopy Phase diagram droplet refer to 29677514 Yes
15-90 µM [FUS RGG3-PY];add MAPT at a molar ratio of 1:5075-300 µM NaCl 20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--25℃N/A-Microscopy Phase diagram droplet refer to 29677514 Yes
30 µM [FUS RGG3-PY];in presence of different amounts(0:1/1:100/1:75/1:50/1:25/1:10) of MAPT RNA75 mM NaCl20 mM Na2HPO4/NaH2PO4, pH 7.5, 2.5% glycerol, 1 mM DTT--RTN/A-Turbidity measurement Yes droplet refer to 29677514 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1