LLPS000073:   FUS_m
General information  
Link to protein
FUS   
Componentsprotein(1) + RNA
Protein structureIDR-fold
Nucleic acid(s)polyU_Repeat:40nt
Modification[FUS]_Mutation(R244C)
Sequence length[FUS]:526aa(1-526)
Sequence>LLPS000073 sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1|length=526aa|residues=1-526|mutation=R244C
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGCGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
1 µM [FUS];1 µM polyU100 mM NaCl50 mM Tris·HCl (pH 7.4), 1 mM EDTA, 1 mM DTT--RTwithin 20 h-Microscopy Yes droplet to solid refer to 30442662 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1