LLPS000075:   FUS_m
General information  
Link to protein
FUS   
Componentsprotein(1) + RNA
Protein structureIDR-fold
Nucleic acid(s)RNA_Blend(Torula yeast RNA)
Modification[FUS]_Mutation(series of S or T at 26, 30, 68, 84, 87, 117 are mutated to E)
Sequence length[FUS]:526aa(1-526)
Sequence>LLPS000075 sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1|length=526aa|residues=1-526|mutation=S or T26:30:68:84:87:117E
MASNDYTQQATQSYGAYPTQPGQGYEQQSEQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGEQSTPQGYGSTGGYGSEQSEQSSYGQQSSYPGYGQQPAPSSTSGSYGSSEQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
5 µM [FUS];0.1 mg/mL RNA150 mM NaCl20 mM Tris pH 7.4--25℃within 1 dagitation 1200 rpmMicroscopy Yes droplet refer to 28790177 Yes
5 µM [FUS];0.05-0.5 mg/mL RNA150 mM NaCl20 mM Tris pH 7.4--25℃after 45 min-Turbidity measurement Yes droplet refer to 28790177 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1