LLPS001027:   SZ1-LAF-1_m + EGFP-SZ2 + mCherry-SZ2
General information  
Link to protein
SZ1    LAF-1    EGFP    SZ2    mCherry   
Componentsprotein(3)
Protein structureIDR + IDR-fold + IDR-fold
Nucleic acid(s)-
Modification[SZ1]-[LAF-1 RGG]2_Fusion_Designed_Cleaved_Repeat(A fusion protein construct in which the designed peptide SZ1 is fused with two LAF-1 RGG domain repeats.)
[EGFP]-[SZ2]_Fusion_Designed(A fusion protein construct of EGFP and a designed peptide SZ2.)
[mCherry]-[SZ2]_Fusion_Designed(A fusion protein construct of mCherry and a designed peptide SZ2.)
Sequence length[SZ1]-[LAF-1 RGG]2:392aa(47;340)
[EGFP]-[SZ2]:299aa(1-239;50)
[mCherry]-[SZ2]:296aa(1-236;50)
Sequence>LLPS001027.1 A fusion protein construct [SZ1]-[LAF-1 RGG]2 with SZ1 fused to two repeats of LAF-1 RGG domain|length=392aa|residues=47
340
NLVAQLENEVASLENENETLKKKNLHKKDLIAYLEKEIANLRKKIEEGMESNQSNNGGSG
NAALNRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGGYDRG
YNDNRDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDRGDGG
SSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGEFLVPRGSMESNQSNNGGSGNAAL
NRGGRYVPPHLRGGDGGAAAAASAGGDDRRGGAGGGGYRRGGGNSGGGGGGGYDRGYNDN
RDDRDNRGGSGGYGRDRNYEDRGYNGGGGGGGNRGYNNNRGGGGGGYNRQDRGDGGSSNF
SRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDG

>LLPS001027.2 A fusion protein construct [EGFP]-[SZ2] with EGFP fused to a designed peptide SZ2|length=299aa|residues=1-239
50
VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL
VTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV
NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD
HYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGG
GSENLYFQGARNAYLRKKIARLKKDNLQLERDEQNLEKIIANLRDEIARLENEVASHEQ

>LLPS001027.3 A fusion protein construct [mCherry]-[SZ2] with mCherry fused to a designed peptide SZ2|length=296aa|residues=1-236
50
VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPF
AWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDG
EFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAE
VKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSE
NLYFQGARNAYLRKKIARLKKDNLQLERDEQNLEKIIANLRDEIARLENEVASHEQ

Phase separation conditions  
Solute concentrationSalt concentrationBufferCrowding agentPressureTemperatureIncubation timeOthersDetection methodPhase separationMorphologyDescriptionReferenceIn vivo/In cell
6 µM [SZ1]-[LAF-1 RGG]2;1 µM [EGFP]-[SZ2];1 µM [mCherry]-[SZ2]150 mM NaCl20 mM Tris, pH 7.5--25℃N/A-Microscopy Yes droplet refer to 30061688 Yes

Copyright@2019 University of Chinese Academy of Sciences.All Rights Reserved.

京ICP备19028953号-1